Structure of PDB 8p16 Chain 6

Receptor sequence

>8p166 (length=361) Species: 83333 (Escherichia coli K-12)

INPVNNRIQDLTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWNEPERA
QALGKERSSLEAVVDTLDQMKQGLEDVSGLLELAVEADDEETFNEAVAEL
DALEEKLAQLEFRRMFSGEYDSADCYLDIQAGSGGTEAQDWASMLERMYL
RWAESRGFKTEIIKESEGEVAGIKSVTIKISGDYAYGWLRTETGVHRLVR
KSPFDSGGRRHTSFSSAFVYPEVDDDIDIEINPADLRIDVYRTSGAGGQH
VNRTESAVRITHIPTGIVTQCQNDRSQHKNKDQAMKQMKAKLYELEMQKK
NAEKQAMEDNKSDIGWGSQIRSYVLDDSRIKDLRTGVETRNTQAVLDGSL
DQFIEASLKAG

3D structure

• PDB: 8p16 The compensatory mechanism of a naturally evolved E167K RF2 counteracting the loss of RF1 in bacteria
• Chain: 6
• Resolution: 2.77 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	6	G135 S136 G138 R200 K204 R213 I317 W319 Q322 D329 D330 R332	G132 S133 G135 R197 K201 R210 I314 W316 Q319 D326 D327 R329
BS02	rna	6	G137 E140 V202 S205 G210 R212 R213 H214 T215	G134 E137 V199 S202 G207 R209 R210 H211 T212
BS03	rna	6	G250 V254 R278	G247 V251 R275
BS04	rna	6	W47 Q54 K58 S61 Q133 S219 Y244 R245 T246 S247 G248 A249 G250 X252 H253 V254 N255 R256 T257 R262 Q273 D277 R278 Q280 H281 K314 S315	W44 Q51 K55 S58 Q130 S216 Y241 R242 T243 S244 G245 A246 G247 X249 H250 V251 N252 R253 T254 R259 Q270 D274 R275 Q277 H278 K311 S312

Gene Ontology

Molecular Function

• GO:0016149 translation release factor activity, codon specific

Biological Process

• GO:0006412 translation
• GO:0006415 translational termination
• GO:0075523 viral translational frameshifting

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:8p16, PDBe:8p16, PDBj:8p16
• PDBsum: 8p16
• UniProt: P07012|RF2_ECOLI Peptide chain release factor RF2 (Gene Name=prfB)