Structure of PDB 8ine Chain 6

Receptor sequence

>8ine6 (length=244) Species: 9606 (Homo sapiens) [Search protein sequence]

MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVH
ASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEER
LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGS
YCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVN
DWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSL

3D structure

PDB

8ine Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	6	E8 N9	E8 N9

Gene Ontology

	Molecular Function
GO:0003743	translation initiation factor activity
GO:0005515	protein binding
GO:0043022	ribosome binding
GO:0043023	ribosomal large subunit binding

	Biological Process
GO:0000054	ribosomal subunit export from nucleus
GO:0000460	maturation of 5.8S rRNA
GO:0000470	maturation of LSU-rRNA
GO:0006110	regulation of glycolytic process
GO:0006412	translation
GO:0006413	translational initiation
GO:0032868	response to insulin
GO:0035195	miRNA-mediated post-transcriptional gene silencing
GO:0035278	miRNA-mediated gene silencing by inhibition of translation
GO:0042254	ribosome biogenesis
GO:0042256	cytosolic ribosome assembly
GO:0042273	ribosomal large subunit biogenesis
GO:0042304	regulation of fatty acid biosynthetic process
GO:0045652	regulation of megakaryocyte differentiation
GO:0045727	positive regulation of translation
GO:1902626	assembly of large subunit precursor of preribosome
GO:2000377	regulation of reactive oxygen species metabolic process

	Cellular Component
GO:0005634	nucleus
GO:0005638	lamin filament
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005882	intermediate filament
GO:0030687	preribosome, large subunit precursor
GO:0045202	synapse
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ine, PDBe:8ine, PDBj:8ine
PDBsum	8ine
PubMed	37491604
UniProt	P56537\|IF6_HUMAN Eukaryotic translation initiation factor 6 (Gene Name=EIF6)

[Back to BioLiP]