Structure of PDB 8d8j Chain 6

Receptor sequence

>8d8j6 (length=250) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

FSRRRIAYPFYPFKKLGRQHPKKHDTNLKTAMRQFLGPKNYKGEYVMNKY
FTVPTNHVPNYIKPDLERGQSLEHPVTKKPLQLRYDGTLGPPPVENKRLQ
NIFKDRLLQPFPSNPHCKTNYVLSPQLKQSIFEEITVEGLSAQQVSQKYG
LKIPRVEAIVKLVSVENSWNRRNRVSSDLKTMDETLYRMFPVFDSNTKVI
YGELVEGERSQYKFTNAKVGKVGYRYGSGNRDNKKDRRIGFNKLGQMVYI

3D structure

PDB

8d8j Principles of mitoribosomal small subunit assembly in eukaryotes.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	6	S28 R29 R30 Y34 F39 K41 L42 R44 Q45 H46 P47 K48 K49 H50 T52 N53 K55 K65 N66 Y67 M73 H100 P101 L115 R198 R200 R304 G322 G324 N325 R326 D327 N328 K329 K330 R332 Y344	S2 R3 R4 Y8 F13 K15 L16 R18 Q19 H20 P21 K22 K23 H24 T26 N27 K29 K39 N40 Y41 M47 H74 P75 L89 R172 R174 R209 G227 G229 N230 R231 D232 N233 K234 K235 R237 Y249

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8d8j, PDBe:8d8j, PDBj:8d8j
PDBsum	8d8j
PubMed	36482135
UniProt	P53292\|RT35_YEAST Small ribosomal subunit protein mS45 (Gene Name=MRPS35)

[Back to BioLiP]