Structure of PDB 7yca Chain 6

Receptor sequence

>7yca6 (length=194) Species: 70448 (Ostreococcus tauri) [Search protein sequence]

RELWYPGAVAPEYLNGSMAGDYGFDPLRLGANVETLPYLQEAELMNGRWA
MAATAGILFTDATGLPKWWEAGAADYGYDFQTLVAFQVVVMGVLEAFRVR
GLMKTPDKRVKEVKNGRLAMVAFLGMVSSYAVTGLSPLEALEAHMANPQA
VNLFTSAVGGESVAFIAFLSCAPTFLLAQKTLGDGKEEFRPIPW

3D structure

PDB

7yca The photosystem I supercomplex from a primordial green alga Ostreococcus tauri harbors three light-harvesting complex trimers.

Chain

Resolution

2.94 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	6	W41 P43 Y59 F61 L230 P234	W4 P6 Y22 F24 L169 P173
BS02	CLA	6	D58 Y59 F61 D62 L66 L76 Q77 A79 E80 N83 R178 M181	D21 Y22 F24 D25 L29 L39 Q40 A42 E43 N46 R117 M120
BS03	CLA	6	A89 A90 G93 L102 A108 Y113	A52 A53 G56 L65 A71 Y76
BS04	CHL	6	Y113 Y115 L120 Q124	Y76 Y78 L83 Q87
BS05	CHL	6	W106 G109 F117 Q124	W69 G72 F80 Q87
BS06	CLA	6	Y75 A79 M82 N83 W86 M128 G129 E132 R135	Y38 A42 M45 N46 W49 M91 G92 E95 R98
BS07	CLA	6	R85 M88 R170 E173 N176	R48 M51 R109 E112 N115
BS08	CLA	6	K169 K172 L179	K108 K111 L118
BS09	CLA	6	V182 A183 G186 S189 V193 T194 A201 H205 N213 L214	V121 A122 G125 S128 V132 T133 A140 H144 N152 L153
BS10	CLA	6	L202 H205 P209 N213 F215	L141 H144 P148 N152 F154
BS11	CLA	6	S189 A192 E222 F226	S128 A131 E161 F165
BS12	CLA	6	E248 F250 R251 P252 I253 P254 W255	E187 F189 R190 P191 I192 P193 W194
BS13	IWJ	6	M88 T91 L179 A183 M187 P198 L202	M51 T54 L118 A122 M126 P137 L141
BS14	CLA	6	G129 A133 V136	G92 A96 V99

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7yca, PDBe:7yca, PDBj:7yca
PDBsum	7yca
PubMed	36951548
UniProt	A0A1Y5IA87

[Back to BioLiP]