Structure of PDB 7unw Chain 6

Receptor sequence
>7unw6 (length=44) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
MKRTFQPSTLKRARVHGFRARMATKNGRQVLSRRRAKGRKRLTV
3D structure
PDB7unw Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
Chain6
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 M1 R3 T4 F5 Q6 S8 T9 L10 K11 R12 A13 R14 H16 F18 R19 R21 K25 N26 R33 R34 R35 K37 G38 R39 K40 R41 M1 R3 T4 F5 Q6 S8 T9 L10 K11 R12 A13 R14 H16 F18 R19 R21 K25 N26 R33 R34 R35 K37 G38 R39 K40 R41
BS02 MG 6 S32 R35 S32 R35
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7unw, PDBe:7unw, PDBj:7unw
PDBsum7unw
PubMed
UniProtP29436|RL34_PSEAE Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]