Structure of PDB 7suk Chain 6

Receptor sequence
>7suk6 (length=277) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MSELNALLKDINGSLTATSESLERLSGIYSNSATDEIPESNQLHEHLFYD
AKKPAEKVSLLSLKNGSMLGYINSLLMLIGNRLDDECKDPSAMDARERSI
QHRVVLERGVKPLEKKLAYQLDKLTRAYVKMEKEYKDAEKRTHFEDRFDA
REHKDRSNKSRMQAMEEYIRESSDQPDWSASIGADIVNHGRGGIKSLRDT
EKERRVTSFEEDNFTRLNITNKAEKRKQKQRERNARMNVIGGEDFGIFSS
KRKLEDSTSRRGAKKTRSAWDRAQRRL
3D structure
PDB7suk Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
Chain6
Resolution3.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 K111 K115 H223 F224 E225 R227 R231 N238 R241 M242 Q243 E246 R271 R278 E281 K305 R306 K309 R316 I327 S330 K331 R332 K111 K115 H143 F144 E145 R147 R151 N158 R161 M162 Q163 E166 R191 R198 E201 K225 R226 K229 R236 I247 S250 K251 R252
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0008150 biological_process
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
GO:0030532 small nuclear ribonucleoprotein complex
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7suk, PDBe:7suk, PDBj:7suk
PDBsum7suk
PubMed35650250
UniProtP40079|LCP5_YEAST U3 small nucleolar ribonucleoprotein protein LCP5 (Gene Name=LCP5)

[Back to BioLiP]