Structure of PDB 7r3k Chain 6

Receptor sequence
>7r3k6 (length=229) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
RPLWLPGSTPPAHLKGDLPGDFGFDPLGLGANAESLKWFKESELVHSRWA
MAAVAGILVQEIVRPDVFWYNAGKEVESPLGPLGLLAVEFFLMHWVEVRR
WQDLRKPGSVDQDPIFSQYKLPPHEVGYPGGVFAPFIPGDLAELKVKEIK
NGRLAMLAFVGFVMAAQVTGKGPIAALQEHLADPWGTTIFSKAAVVPGQA
VAPPCKIPASVSYKGIEIPTPCFLQGLWP
3D structure
PDB7r3k Structure of Photosystem I Supercomplex Isolated from a Chlamydomonas reinhardtii Cytochrome b6f Temperature-Sensitive Mutant.
Chain6
Resolution2.52 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA 6 A115 V116 F119 A87 V88 F91
BS02 CLA 6 L205 H208 L209 P212 T216 F218 L177 H180 L181 P184 T188 F190
BS03 CLA 6 P249 C250 L252 Q253 G254 P221 C222 L224 Q225 G226
BS04 CLA 6 F119 W123 V126 R127 F91 W95 V98 R99
BS05 CLA 6 R76 M79 Y156 P157 G158 P166 L169 L172 K173 E176 R48 M51 Y128 P129 G130 P138 L141 L144 K145 E148
BS06 CLA 6 P166 K175 N179 L182 P138 K147 N151 L154
BS07 CLA 6 L185 A186 G189 M192 V196 T197 E207 H208 I217 L157 A158 G161 M164 V168 T169 E179 H180 I189
BS08 CLA 6 L46 G48 D49 F50 F52 D53 L57 L64 F67 K68 S70 E71 H74 R181 M184 L185 L18 G20 D21 F22 F24 D25 L29 L36 F39 K40 S42 E43 H46 R153 M156 L157
BS09 CLA 6 W77 A80 G84 Q88 V104 W49 A52 G56 Q60 V76
BS10 CLA 6 K175 K178 N179 L182 K147 K150 N151 L154
BS11 CHL 6 W32 L33 P34 F50 W4 L5 P6 F22
BS12 CHL 6 Y98 N99 G101 K102 E117 V239 Y241 P247 T248 Y70 N71 G73 K74 E89 V211 Y213 P219 T220
BS13 CHL 6 R76 W77 V124 R127 R128 D131 V138 P157 F161 R48 W49 V96 R99 R100 D103 V110 P129 F133
BS14 CLA 6 W66 S70 V73 H74 W77 M121 H122 E125 R128 W129 W38 S42 V45 H46 W49 M93 H94 E97 R100 W101
BS15 CHL 6 V104 L113 E117 F161 V76 L85 E89 F133
BS16 CLA 6 M192 I217 F251 L252 W256 P257 M164 I189 F223 L224 W228 P229
BS17 CHL 6 R127 D141 P142 I143 F144 Y147 L149 R99 D113 P114 I115 F116 Y119 L121
BS18 CLA 6 F118 H122 W129 F90 H94 W101
BS19 CLA 6 F218 A221 V223 V224 P225 P257 F190 A193 V195 V196 P197 P229
BS20 ERG 6 E62 W66 W129 R133 E34 W38 W101 R105
Gene Ontology
Molecular Function
GO:0016168 chlorophyll binding
Biological Process
GO:0009416 response to light stimulus
GO:0009765 photosynthesis, light harvesting
GO:0009768 photosynthesis, light harvesting in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r3k, PDBe:7r3k, PDBj:7r3k
PDBsum7r3k
PubMed36979472
UniProtQ75VY6

[Back to BioLiP]