Structure of PDB 7p48 Chain 6

Receptor sequence

>7p486 (length=510) Species: 42858 (Mammaliicoccus lentus)

MLFLFEEKPLEIENKQLIKRLSFHIEDHEHLALIGVNGIGKSTLLHHIHK
NELIDTAMMEQDLSKHDDIDVMDYVMSAYIIIEGNKLGLSSTHFEQKIGT
LSGGEQTKVSFLKVILSDAPLLLIDQPTNHMDKEMKVWLIKAFKSEQRAI
LFVSHDREFLNETPDAILELTKDGATRYSGHYDDYKNQKDIEIETEKLKY
EKEQKEQKAIEESIKKYKEWYQRAAQKASVRSPYAQKQLSKLAKRFKSKE
HQLNRKLEESKSDNPLEENKSFSIENNEFKSHYLVRFENVSFSYKSREIF
KDTYFEIKRNQTVIIEGKNGSGKSTLIQLILGNLLPMSGAVKKHPDLDIG
YFSQDFQNLNPNNSVLEEVMDIENMMITDARTILASFYFDKSRMNDKVRQ
LSMGEKCRLQFVKLYFSNPHILILDQPTNYFDISMQEKIIQLIQSFNGAV
IIVSHDEIFKDEIRDQVWKIENCKLIHENVSINTPIDAESMKDELKILEQ
YTDERNKETD

3D structure

• PDB: 7p48 Sal-type ABC-F proteins: intrinsic and common mediators of pleuromutilin resistance by target protection in staphylococci.
• Chain: 6
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	6	K245 F302 S303 T408 R411 T412 A415 S416	K215 F272 S273 T378 R381 T382 A385 S386
BS02	rna	6	H24 Q218 T225 K232 Y247 W250 Y251 S259 R261 P263 Y264 Q266 K267 Q268 S270 K271 K274 R275 H281 R285	H24 Q188 T195 K202 Y217 W220 Y221 S229 R231 P233 Y234 Q236 K237 Q238 S240 K241 K244 R245 H251 R255
BS03	rna	6	H312 K372	H282 K342
BS04	ATP	6	I12 E13 N37 G38 G40 K41 S42 Q430 S432 M433 G434	I12 E13 N37 G38 G40 K41 S42 Q400 S402 M403 G404
BS05	ATP	6	T130 S132 G134 E135 Y324 N349 G350 G352 K353 S354 T355 Q384	T100 S102 G104 E105 Y294 N319 G320 G322 K323 S324 T325 Q354
BS06	MG	6	S42 Q61	S42 Q61
BS07	MG	6	S354 Q384	S324 Q354

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 09:40:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7p48', asym_id = '6', title = 'Sal-type ABC-F proteins: intrinsic and common me...resistance by target protection in staphylococci.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7p48', asym_id='6', title='Sal-type ABC-F proteins: intrinsic and common me...resistance by target protection in staphylococci.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0005524,0016887', uniprot = '', pdbid = '7p48', asym_id = '6'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005524,0016887', uniprot='', pdbid='7p48', asym_id='6')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>