Structure of PDB 7oj0 Chain 6

Receptor sequence
>7oj06 (length=46) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MSRYQHTKGQIKDNAIEALLHDPLFRQRVEKNKKGKGSYMRKGKHG
3D structure
PDB7oj0 Structural basis of l-tryptophan-dependent inhibition of release factor 2 by the TnaC arrest peptide.
Chain6
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 T7 H21 P23 R26 Q27 R28 V29 E30 K33 K34 K36 Y39 R41 K42 K44 H45 T7 H21 P23 R26 Q27 R28 V29 E30 K33 K34 K36 Y39 R41 K42 K44 H45
BS02 rna 6 K8 K12 D13 N14 E17 A18 H21 K8 K12 D13 N14 E17 A18 H21
BS03 rna 6 Q27 R28 V29 Q27 R28 V29
Gene Ontology
Biological Process
GO:0072344 rescue of stalled ribosome

View graph for
Biological Process
External links
PDB RCSB:7oj0, PDBe:7oj0, PDBj:7oj0
PDBsum7oj0
PubMed34403461
UniProtP36675|ARFA_ECOLI Alternative ribosome-rescue factor A (Gene Name=arfA)

[Back to BioLiP]