Structure of PDB 7o5b Chain 6 |
>7o5b6 (length=63) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] |
MKAGIHPNFKKATVKCACGNEFETGSVKEEVRVEICSECHPFYTGRQKFA SADGRVDRFNKKY |
|
PDB | 7o5b Inhibition of SRP-dependent protein secretion by the bacterial alarmone (p)ppGpp. |
Chain | 6 |
Resolution | 3.33 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
6 |
M1 K2 I5 |
M1 K2 I5 |
|
|
|
|