Structure of PDB 7nhm Chain 6

Receptor sequence
>7nhm6 (length=47) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
RVNVTLACTECGDRNYITTKNKRNNPERVEMKKFCSRENKQTLHRET
3D structure
PDB7nhm Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
Chain6
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 Y17 T19 T20 N22 N25 N26 M32 K33 K34 F35 Q42 Y16 T18 T19 N21 N24 N25 M31 K32 K33 F34 Q41
BS02 ZN 6 C9 C36 C8 C35
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nhm, PDBe:7nhm, PDBj:7nhm
PDBsum7nhm
PubMed34117249
UniProtQ2FY22|RL332_STAA8 Large ribosomal subunit protein bL33B (Gene Name=rpmG2)

[Back to BioLiP]