Structure of PDB 7msz Chain 6

Receptor sequence
>7msz6 (length=57) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
MKSDIHPAYEETTVVCGCGNTFQTRSTKPGGRIVVEVCSQCHPFYTGGRV
ARFEKRY
3D structure
PDB7msz Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Chain6
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 M1 K2 H6 M1 K2 H6
BS02 rna 6 R60 K63 R52 K55
BS03 ZN 6 C38 C41 C38 C41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7msz, PDBe:7msz, PDBj:7msz
PDBsum7msz
PubMed35064151
UniProtP9WHA1|RL31_MYCTU Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]