Structure of PDB 7dz8 Chain 6

Receptor sequence
>7dz86 (length=230) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
SRPLWLPGSTPPAHLKGDLPGDFGFDPLGLGANAESLKWFKESELVHSRW
AMAAVAGILVQEIVRPDVFWYNAGKEVESPLGPLGLLAVEFFLMHWVEVR
RWQDLRKPGSVDQDPIFSQYKLPPHEVGYPGGVFAPFIPGDLAELKVKEI
KNGRLAMLAFVGFVMAAQVTGKGPIAALQEHLADPWGTTIFSKAAVVPGQ
AVAPPCKIPASVSYKGIEIPTPCFLQGLWP
3D structure
PDB7dz8 Structural basis of LhcbM5-mediated state transitions in green algae.
Chain6
Resolution3.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA 6 F119 H122 W123 R127 F92 H95 W96 R100
BS02 CLA 6 W32 L33 P34 F52 W5 L6 P7 F25
BS03 CLA 6 L42 L46 G48 D49 F50 F52 D53 L57 G58 F67 K68 S70 E71 R181 M184 L185 L15 L19 G21 D22 F23 F25 D26 L30 G31 F40 K41 S43 E44 R154 M157 L158
BS04 CLA 6 W66 F67 H74 W39 F40 H47
BS05 CLA 6 W77 A80 A81 G84 V87 Q88 A100 W50 A53 A54 G57 V60 Q61 A73
BS06 CLA 6 S106 L113 E117 S79 L86 E90
BS07 CLA 6 Y98 N99 G101 E117 Y241 T248 Y71 N72 G74 E90 Y214 T221
BS08 CLA 6 R76 W77 V124 R127 R128 D131 H152 P157 F161 R49 W50 V97 R100 R101 D104 H125 P130 F134
BS09 CLA 6 W66 S70 V73 H74 W77 F118 M121 H122 E125 R128 W129 W39 S43 V46 H47 W50 F91 M94 H95 E98 R101 W102
BS10 CLA 6 R76 M79 Y156 P157 G158 F161 A162 I165 L172 K173 E176 R49 M52 Y129 P130 G131 F134 A135 I138 L145 K146 E149
BS11 CLA 6 K175 K178 N179 L182 K148 K151 N152 L155
BS12 CLA 6 K175 N179 K148 N152
BS13 CLA 6 L185 A186 G189 M192 V196 H208 T216 I217 K220 L158 A159 G162 M165 V169 H181 T189 I190 K193
BS14 CLA 6 L205 H208 L209 P212 T216 F218 L178 H181 L182 P185 T189 F191
BS15 CLA 6 F218 A221 V223 V224 P225 P257 F191 A194 V196 V197 P198 P230
BS16 CLA 6 F118 H122 W129 F91 H95 W102
BS17 CLA 6 R127 D141 P142 I143 F144 Y147 L149 V160 R100 D114 P115 I116 F117 Y120 L122 V133
BS18 CLA 6 V188 M192 I217 F251 W256 P257 V161 M165 I190 F224 W229 P230
BS19 CLA 6 C250 F251 L252 Q253 C223 F224 L225 Q226
Gene Ontology
Molecular Function
GO:0016168 chlorophyll binding
Biological Process
GO:0009416 response to light stimulus
GO:0009765 photosynthesis, light harvesting
GO:0009768 photosynthesis, light harvesting in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dz8, PDBe:7dz8, PDBj:7dz8
PDBsum7dz8
PubMed34239095
UniProtQ75VY6

[Back to BioLiP]