Structure of PDB 7c9r Chain 6

Receptor sequence
>7c9r6 (length=43) Species: 631362 (Thiorhodovibrio frisius) [Search protein sequence]
KSTTGLTEAESKEFHGIFMASMTLWFGLVVLAHILSWLYRPWL
3D structure
PDB7c9r Cryo-EM structure of a Ca 2+ -bound photosynthetic LH1-RC complex containing multiple alpha beta-polypeptides.
Chain6
Resolution2.82 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL 6 W28 L31 A35 H36 W25 L28 A32 H33
BS02 BCL 6 F29 V32 H36 W45 F26 V29 H33 W42
BS03 H4X 6 E16 F17 I20 F21 S24 M25 F29 E13 F14 I17 F18 S21 M22 F26
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c9r, PDBe:7c9r, PDBj:7c9r
PDBsum7c9r
PubMed33009385
UniProtG1BIY4

[Back to BioLiP]