Structure of PDB 6zkl Chain 6

Receptor sequence
>6zkl6 (length=156) Species: 9940 (Ovis aries) [Search protein sequence]
SRGEYVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFG
VVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGG
GYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRL
RIWYRR
3D structure
PDB6zkl The coupling mechanism of mammalian respiratory complex I.
Chain6
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 970 6 T49 G51 L52 M59 M60 F76 T26 G28 L29 M36 M37 F53
BS02 SF4 6 C54 C55 G117 S118 C119 C149 P150 C31 C32 G94 S95 C96 C126 P127
BS03 970 6 V75 R77 V52 R54
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Apr 27 01:53:47 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zkl', asym_id = '6', title = 'The coupling mechanism of mammalian respiratory complex I.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zkl', asym_id='6', title='The coupling mechanism of mammalian respiratory complex I.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0008137,0048038,0051536,0051539', uniprot = '', pdbid = '6zkl', asym_id = '6'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008137,0048038,0051536,0051539', uniprot='', pdbid='6zkl', asym_id='6')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>