Structure of PDB 6yss Chain 6

Receptor sequence

>6yss6 (length=66) Species: 562 (Escherichia coli)

MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRD
VATGGRVDRFNKRFNI

3D structure

• PDB: 6yss Mechanism of ribosome rescue by alternative ribosome-rescue factor B.
• Chain: 6
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	6	M1 K2 H6	M1 K2 H6
BS02	rna	6	R59 R63	R59 R63
BS03	ZN	6	C16 C18 C40	C16 C18 C40

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Feb 26 22:58:16 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6yss', asym_id = '6', title = 'Mechanism of ribosome rescue by alternative ribosome-rescue factor B.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6yss', asym_id='6', title='Mechanism of ribosome rescue by alternative ribosome-rescue factor B.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6yss', asym_id = '6'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6yss', asym_id='6')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>