Structure of PDB 6wu9 Chain 6

Receptor sequence
>6wu96 (length=38) Species: 474186 (Enterococcus faecalis OG1RF) [Search protein sequence]
MKVRPSVKPMCEHCKVIRRKGRVMVICPANPKHKQRQG
3D structure
PDB6wu9 Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
Chain6
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 M1 P5 S6 V7 K8 R18 R19 K32 K34 R36 Q37 M1 P5 S6 V7 K8 R18 R19 K32 K34 R36 Q37
BS02 ZN 6 C11 H33 C11 H33
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wu9, PDBe:6wu9, PDBj:6wu9
PDBsum6wu9
PubMed33004869
UniProtQ839E1|RL36_ENTFA Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]