Structure of PDB 6spf Chain 6

Receptor sequence
>6spf6 (length=38) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]
MKVRASVKKLCRNCKIIRRDGIVRVICSAEPRHKQRQG
3D structure
PDB6spf Structure ofPseudomonas aeruginosaribosomes from an aminoglycoside-resistant clinical isolate.
Chain6
Resolution2.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 M1 K2 R4 A5 S6 V7 L10 R12 I16 R18 R19 D20 V23 R24 P31 R32 K34 R36 Q37 G38 M1 K2 R4 A5 S6 V7 L10 R12 I16 R18 R19 D20 V23 R24 P31 R32 K34 R36 Q37 G38
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6spf, PDBe:6spf, PDBj:6spf
PDBsum6spf
PubMed31611393
UniProtE2RXU2

[Back to BioLiP]