Structure of PDB 6mti Chain 6 |
>6mti6 (length=127) Species: 10116 (Rattus norvegicus) [Search protein sequence] |
KLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKK KKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDII GEFKVPMNTVDFGHVTEEWRDLQSAEK |
|
PDB | 6mti Structural basis for the clamping and Ca2+activation of SNARE-mediated fusion by synaptotagmin. |
Chain | 6 |
Resolution | 10.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
6 |
D172 D178 F231 D232 |
D32 D38 F91 D92 |
|
|
|
|