Structure of PDB 6et5 Chain 6

Receptor sequence
>6et56 (length=58) Species: 1079 (Blastochloris viridis) [Search protein sequence]
ATEYRTASWKLWLILDPRRVLTALFVYLTVIALLIHFGLLSTDRLNWWEF
QRGLPKAA
3D structure
PDB6et5 Cryo-EM structure of the Blastochloris viridis LH1-RC complex at 2.9 angstrom.
Chain6
Resolution2.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide 6 R5 T6 S8 R5 T6 S8
BS02 UQ9 6 Y27 F37 Y27 F37
BS03 BCB 6 L21 F25 T29 H36 W47 W48 L21 F25 T29 H36 W47 W48
BS04 NS0 6 L33 H36 L33 H36
BS05 BCB 6 L28 I31 A32 I35 H36 L39 L28 I31 A32 I35 H36 L39
Gene Ontology
Molecular Function
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6et5, PDBe:6et5, PDBj:6et5
PDBsum6et5
PubMed29618818
UniProtP04123|LHA_BLAVI Light-harvesting protein B-1015 alpha chain (Gene Name=pufA)

[Back to BioLiP]