Structure of PDB 5wfs Chain 6

Receptor sequence
>5wfs6 (length=66) Species: 562 (Escherichia coli) [Search protein sequence]
MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRD
VATGGRVDRFNKRFNI
3D structure
PDB5wfs Cryo-EM shows stages of initial codon selection on the ribosome by aa-tRNA in ternary complex with GTP and the GTPase-deficient EF-TuH84A.
Chain6
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 M1 K2 H6 M1 K2 H6
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006413 translational initiation
GO:1904689 negative regulation of cytoplasmic translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wfs, PDBe:5wfs, PDBj:5wfs
PDBsum5wfs
PubMed29733411
UniProtP0A7M9|RL31_ECOLI Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]