Structure of PDB 5mdx Chain 6

Receptor sequence

>5mdx6 (length=219) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRE
LEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYL
GNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFD
PLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADH
LADPVNNNAWAFATNFVPG

3D structure

PDB

5mdx Subunit and chlorophyll organization of the plant photosystem II supercomplex.

Chain

Resolution

5.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	6	K57 Y58 L59 W80	K10 Y11 L12 W33
BS02	CLA	6	G76 D77 Y78 W80 D81 F92 N95 R96 L98 E99 H102 R220 M223	G29 D30 Y31 W33 D34 F45 N48 R49 L51 E52 H55 R173 M176
BS03	CLA	6	L108 G112 P116 Y146	L61 G65 P69 Y99
BS04	CHL	6	S151 L152 V153 H154 S157 I161	S104 L105 V106 H107 S110 I114
BS05	CHL	6	R104 W105 Y175 R176 L183 G184 A186 L189 P192 F196	R57 W58 Y128 R129 L136 G137 A139 L142 P145 F149
BS06	CHL	6	I101 W105 M169 G170 E173	I54 W58 M122 G123 E126
BS07	CLA	6	R104 M107 Y191 P192 G193 F196 D197 F208 E215 N218	R57 M60 Y144 P145 G146 F149 D150 F161 E168 N171
BS08	CLA	6	W50 K214 K217	W3 K167 K170
BS09	CLA	6	K214 N218 L221	K167 N171 L174
BS10	CLA	6	F224 S225 G228 Q232 T236 N243 N255 A256 F259	F177 S178 G181 Q185 T189 N196 N208 A209 F212
BS11	CLA	6	H247 P251	H200 P204
BS12	CLA	6	L159 W162	L112 W115

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5mdx, PDBe:5mdx, PDBj:5mdx
PDBsum	5mdx
PubMed	28604725
UniProt	P04778\|CB1C_ARATH Chlorophyll a-b binding protein 1, chloroplastic (Gene Name=LHCB1.3)

[Back to BioLiP]