Structure of PDB 5mdv Chain 6

Receptor sequence
>5mdv6 (length=46) Species: 562 (Escherichia coli) [Search protein sequence]
MSRYQHTKGQIKDNAIEALLHDPLFRQRVEKNKKGKGSYMRKGKHG
3D structure
PDB5mdv Translational termination without a stop codon.
Chain6
Resolution2.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 6 K8 Q10 K12 D13 N14 A18 H21 K8 Q10 K12 D13 N14 A18 H21
BS02 rna 6 T7 R26 Q27 R28 E30 K34 K36 G37 Y39 R41 K44 H45 T7 R26 Q27 R28 E30 K34 K36 G37 Y39 R41 K44 H45
Gene Ontology
Biological Process
GO:0072344 rescue of stalled ribosome

View graph for
Biological Process
External links
PDB RCSB:5mdv, PDBe:5mdv, PDBj:5mdv
PDBsum5mdv
PubMed27934701
UniProtP36675|ARFA_ECOLI Alternative ribosome-rescue factor A (Gene Name=arfA)

[Back to BioLiP]