Structure of PDB 5b5m Chain 6

Receptor sequence
>5b5m6 (length=40) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]
TGLTDDEAKEFHAIFMQSMYAWFGLVVIAHLLAWLYRPWL
3D structure
PDB5b5m Structural Basis for the Unusual Qy Red-Shift and Enhanced Thermostability of the LH1 Complex from Thermochromatium tepidum.
Chain6
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL 6 W28 L31 H36 W22 L25 H30
BS02 BCL 6 F29 V32 H36 W40 W45 F23 V26 H30 W34 W39
BS03 CRT 6 E16 F17 I20 F21 S24 M25 E10 F11 I14 F15 S18 M19
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5b5m, PDBe:5b5m, PDBj:5b5m
PDBsum5b5m
PubMed27933779
UniProtD2Z0P1

[Back to BioLiP]