Structure of PDB 4xk8 Chain 6

Receptor sequence

>4xk86 (length=195) Species: 3888 (Pisum sativum) [Search protein sequence]

AHWMPGEPRPAYLDGSAPGDFGFDPLGLGEVPANLERYKESELIHCRWAM
LAVPGILVPEALGYGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILAIE
FLAIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKLEELKVKEIKNG
RLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDILIGF

3D structure

PDB

4xk8 Structural basis for energy transfer pathways in the plant PSI-LHCI supercomplex

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	6	N68 Y72	N34 Y38
BS02	CHL	6	W37 M38 P39 F55 F57	W3 M4 P5 F21 F23
BS03	CLA	6	G53 D54 F55 F57 D58 G63 Y72 K73 E76 H79 R185 L188	G19 D20 F21 F23 D24 G29 Y38 K39 E42 H45 R151 L154
BS04	CLA	6	Y72 H79	Y38 H45
BS05	CLA	6	L85 G89 A104 Y117 L118	L51 G55 A70 Y83 L84
BS06	CLA	6	W107 W124 I130 E134	W73 W90 I96 E100
BS07	CHL	6	V102 Q105 A108 E134	V68 Q71 A74 E100
BS08	CLA	6	R81 W82 V141 Q144 R145 P157 F161	R47 W48 V107 Q110 R111 P123 F127
BS09	CLA	6	E74 S75 I78 H79 W82 I138 A139 E142 R145	E40 S41 I44 H45 W48 I104 A105 E108 R111
BS10	CLA	6	R81 M84 L85 Y156 P157 G158 F161 Y166 L176 K177 K179 E180	R47 M50 L51 Y122 P123 G124 F127 Y132 L142 K143 K145 E146
BS11	CLA	6	K179 K182 N183	K145 K148 N149
BS12	CLA	6	N183 L186	N149 L152
BS13	CLA	6	L189 G193 V196 Q197 Y201 N209 H213 N221 I222 I225	L155 G159 V162 Q163 Y167 N175 H179 N187 I188 I191
BS14	CLA	6	L210 H213 L214 P217	L176 H179 L180 P183

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4xk8, PDBe:4xk8, PDBj:4xk8
PDBsum	4xk8
PubMed	26023133
UniProt	Q01667\|CAB6_ARATH Chlorophyll a-b binding protein 6, chloroplastic (Gene Name=LHCA1)

[Back to BioLiP]