Structure of PDB 3ias Chain 6

Receptor sequence

>3ias6 (length=145) Species: 300852 (Thermus thermophilus HB8)

EREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSV
VPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERGERLPPVAA

3D structure

• PDB: 3ias Structural basis for the mechanism of respiratory complex I
• Chain: 6
• Resolution: 3.15 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	6	C45 C46 G82 R83 A110 C111 C140 P141	C31 C32 G52 R53 A80 C81 C110 P111

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0046872 metal ion binding
• GO:0048038 quinone binding
• GO:0050136 NADH:ubiquinone reductase (non-electrogenic) activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009060 aerobic respiration
• GO:0015990 electron transport coupled proton transport

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:3ias, PDBe:3ias, PDBj:3ias
• PDBsum: 3ias
• PubMed: 19635800
• UniProt: Q56218|NQO6_THET8 NADH-quinone oxidoreductase subunit 6 (Gene Name=nqo6)