Structure of PDB 8h6e Chain 5f |
>8h6e5f (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] |
KAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSG QQNNIGMVVIRGNSIIMLEALERV |
|
PDB | 8h6e Structural Insights into Human Exon-defined Spliceosome Prior to Activation |
Chain | 5f |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
5f |
N22 G23 F37 |
N20 G21 F35 |
|
|
|
|