Structure of PDB 8ugn Chain 5R |
>8ugn5R (length=96) Species: 9823 (Sus scrofa) [Search protein sequence] |
GVRTSPTGEKVTHTGQAYDDGDYRRVRFSDRQKEVNENFAIDLIAEQPVS EVGSRVISCDGGGGALGHPRVYINLDKETKTGTCGYCGLQFRQPHH |
|
PDB | 8ugn High-resolution in situ structures of mammalian respiratory supercomplexes. |
Chain | 5R |
Resolution | 2.7 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
5R |
C59 H68 C84 |
C59 H68 C84 |
|
|
|
|