Structure of PDB 6ke6 Chain 5K

Receptor sequence
>6ke65K (length=175) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TRKFGLVKRTLNTKKDQRLKKNQENLTRNIPQVSSALFFQYNQAIKPPYQ
VLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLGPKYR
IALKLARDPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLKQRI
RKIPGIPLMSVGGHAYVIEKLPDVF
3D structure
PDB6ke6 3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
Chain5K
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 5K Q23 N31 K133 G134 Y136 Q17 N25 K119 G120 Y122
BS02 rna 5K V13 K14 K21 V7 K8 K15
BS03 rna 5K R42 I44 A158 Q162 R163 K166 R28 I30 A144 Q148 R149 K152
BS04 ZN 5K C101 C130 H132 C140 C87 C116 H118 C126
Gene Ontology
Molecular Function
GO:0004521 RNA endonuclease activity
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0032040 small-subunit processome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6ke6, PDBe:6ke6, PDBj:6ke6
PDBsum6ke6
PubMed
UniProtQ05498|FCF1_YEAST rRNA-processing protein FCF1 (Gene Name=FCF1)

[Back to BioLiP]