Structure of PDB 7d5s Chain 5J

Receptor sequence
>7d5s5J (length=151) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SKFQEIETNLKKLPKLETGFDALANKKKKKNVLPSNDWFTLPKPDDNMRR
EVQRDLLLIKHRAALDPKRHYKKQRWEVPERFAIGTIIEDKSEFYSSRMN
RKERKSTILETLMGDEASNKYFKRKYNEIQEKSTSGRKAHYKKMKEMRKK
R
3D structure
PDB7d5s Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
Chain5J
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5J K60 Q195 R202 K203 K207 K11 Q130 R137 K138 K142
BS02 rna 5J P132 K133 H135 Y136 K137 K138 R189 K190 G201 R202 Y206 K210 R213 P67 K68 H70 Y71 K72 K73 R124 K125 G136 R137 Y141 K145 R148
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7d5s, PDBe:7d5s, PDBj:7d5s
PDBsum7d5s
PubMed
UniProtQ12035|FCF2_YEAST rRNA-processing protein FCF2 (Gene Name=FCF2)

[Back to BioLiP]