Structure of PDB 4wr6 Chain 5I

Receptor sequence
>4wr65I (length=61) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHK
GQLPGVRKASW
3D structure
PDB4wr6 Structural insights into the translational infidelity mechanism.
Chain5I
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5I M1 A2 R3 K4 A5 L6 K9 R12 K15 F16 K17 V18 R19 Y21 T22 C27 R29 R31 S32 Y34 R35 R41 I42 R45 E46 K58 S60 W61 M1 A2 R3 K4 A5 L6 K9 R12 K15 F16 K17 V18 R19 Y21 T22 C27 R29 R31 S32 Y34 R35 R41 I42 R45 E46 K58 S60 W61
BS02 ZN 5I C24 C27 C40 C43 C24 C27 C40 C43
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wr6, PDBe:4wr6, PDBj:4wr6
PDBsum4wr6
PubMed26037619
UniProtP0DOY6|RS14Z_THET8 Small ribosomal subunit protein uS14 (Gene Name=rpsZ)

[Back to BioLiP]