Structure of PDB 8snb Chain 5G |
>8snb5G (length=142) Species: 7668 (Strongylocentrotus purpuratus) [Search protein sequence] |
NSSNYTPTIPRAPIAAHFTGPGPNVMLPSCLGNGTAINKREMPQFSFGVR HKSYSTDYSPGPCHNFPAGVTRKGNDGTPKYSLYARSKELTAFKTPGPGS YSPEKAGRSAHLHAPEHTFGSRTKGITFDKSPAPNNYSLPSI |
|
PDB | 8snb Structural specializations of the sperm tail. |
Chain | 5G |
Resolution | 3.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
5G |
A17 H18 T20 |
A16 H17 T19 |
|
|
|
|