Structure of PDB 6ke6 Chain 5G

Receptor sequence

>6ke65G (length=282) Species: 559292 (Saccharomyces cerevisiae S288C)

MLRRQARERREYLYRKAQELQDSQLQQKRQIIKQALAQGKPLPKELAEDE
SLQKDFRYDQSLKQVDDEYAATSGIMDPRIIVTTSRDPSTRLSQFAKEIK
LLFPNAVRLNRGNYVMPNLVDACKKSGTTDLVVLHEHRGVPTSLTISHFP
HGPTAQFSLHNVVMRHDIINAGNQSEVNPHLIFDNFTTALGKRVVCILKH
LFNAGPKKDSERVITFANRGDFISVRQHVYVRTREGVEIAEVGPRFEMRL
FELRLGTLENKDADVEWQLRRFIRTANKKDYL

3D structure

• PDB: 6ke6 3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
• Chain: 5G
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	5G	E11 Y14	E11 Y14
BS02	rna	5G	K40 S93 R94 Q102 K105 N118 R119 G120 N121 Y122 V123 E144 H145 R146 G147 T150 S151 S166 H174 N181 S183 F259 Q276 L277 R278 R279 R282 T283 K287	K40 S85 R86 Q94 K97 N110 R111 G112 N113 Y114 V115 E136 H137 R138 G139 T142 S143 S158 H166 N173 S175 F251 Q268 L269 R270 R271 R274 T275 K279

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0030515 snoRNA binding
• GO:0042134 rRNA primary transcript binding
• GO:0043047 single-stranded telomeric DNA binding

Biological Process

• GO:0006364 rRNA processing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome
• GO:0034457 Mpp10 complex
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ke6, PDBe:6ke6, PDBj:6ke6
• PDBsum: 6ke6
• UniProt: P53941|IMP4_YEAST U3 small nucleolar ribonucleoprotein protein IMP4 (Gene Name=IMP4)