Structure of PDB 6lqu Chain 5F

Receptor sequence

>6lqu5F (length=182) Species: 559292 (Saccharomyces cerevisiae S288C)

VRKLKHHEQKLLKKVDFLEWKQDQGHRDTQVMRTYHIQNREDYHKYNRIC
GDIRRLANKLSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKSKISDLENKV
TVSAICRRRLPVIMHRLKMAETIQDAVKFIEQGHVRVGPNLINDPAYLVT
RNMEDYVTWVDNSKIKKTLLRYRNQIDDFDFS

3D structure

• PDB: 6lqu Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
• Chain: 5F
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	5F	H7 H8 K11 L13 K14 K15 Q133 H135 K165	H6 H7 K10 L12 K13 K14 Q132 H134 K164
BS02	rna	5F	V2 R3 K4 Q25 R28 M33 R34 H37 Y44 N48 R49 G52 R55 R56 N59 T89 T102 V103 S104 R108 H116 R117 Q125	V1 R2 K3 Q24 R27 M32 R33 H36 Y43 N47 R48 G51 R54 R55 N58 T88 T101 V102 S103 R107 H115 R116 Q124

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0030515 snoRNA binding

Biological Process

• GO:0006364 rRNA processing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome
• GO:0034457 Mpp10 complex
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6lqu, PDBe:6lqu, PDBj:6lqu
• PDBsum: 6lqu
• PubMed: 32943522
• UniProt: P32899|IMP3_YEAST U3 small nucleolar ribonucleoprotein protein IMP3 (Gene Name=IMP3)