Structure of PDB 6lqq Chain 5F

Receptor sequence
>6lqq5F (length=182) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
VRKLKHHEQKLLKKVDFLEWKQDQGHRDTQVMRTYHIQNREDYHKYNRIC
GDIRRLANKLSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKSKISDLENKV
TVSAICRRRLPVIMHRLKMAETIQDAVKFIEQGHVRVGPNLINDPAYLVT
RNMEDYVTWVDNSKIKKTLLRYRNQIDDFDFS
3D structure
PDB6lqq Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
Chain5F
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5F H7 H8 K11 L13 K14 K15 Q133 H135 K165 H6 H7 K10 L12 K13 K14 Q132 H134 K164
BS02 rna 5F V2 R3 K4 Q25 R28 Y44 N48 R49 G52 R55 R56 N59 T102 V103 S104 R108 V1 R2 K3 Q24 R27 Y43 N47 R48 G51 R54 R55 N58 T101 V102 S103 R107
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0030515 snoRNA binding
Biological Process
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:0034457 Mpp10 complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lqq, PDBe:6lqq, PDBj:6lqq
PDBsum6lqq
PubMed32943522
UniProtP32899|IMP3_YEAST U3 small nucleolar ribonucleoprotein protein IMP3 (Gene Name=IMP3)

[Back to BioLiP]