Structure of PDB 6lqq Chain 5E

Receptor sequence

>6lqq5E (length=204) Species: 559292 (Saccharomyces cerevisiae S288C)

KNLSSFEKQQIEIRKQIEQLENEAVAEKKWSLKGEVKAKDRPEDALLTEE
LEFDRTAKPVPVITSEVTESLEDMIRRRIQDSNFDDLQRRALSEELQKAH
SEISELYANLVYKLDVLSSVHFVPKPASTSLEIRVETPTISMEDAQPLYM
SNASSLAPQEIYNVGKAEKDGEIRLKNGVAMSKEELTREDKNRLRRALKR
KRSK

3D structure

• PDB: 6lqq Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
• Chain: 5E
• Resolution: 4.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	5E	G328 E329 R468 Q493 K500 D504 L509 N511 M515 K517 R522 K525 R527 R529 R530 L532 R534 K535 R536 S537 K538	G34 E35 R134 Q159 K166 D170 L175 N177 M181 K183 R188 K191 R193 R195 R196 L198 R200 K201 R202 S203 K204

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0005515 protein binding
• GO:0042802 identical protein binding

Biological Process

• GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome
• GO:0034457 Mpp10 complex
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6lqq, PDBe:6lqq, PDBj:6lqq
• PDBsum: 6lqq
• PubMed: 32943522
• UniProt: P47083|MPP10_YEAST U3 small nucleolar RNA-associated protein MPP10 (Gene Name=MPP10)