Structure of PDB 6qx9 Chain 5D |
>6qx95D (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] |
SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEK VKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNK INWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY |
|
PDB | 6qx9 Mechanism of 5' splice site transfer for human spliceosome activation. |
Chain | 5D |
Resolution | 3.28 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
5D |
R124 K125 G126 |
R123 K124 G125 |
|
|
|
|