Structure of PDB 6lqu Chain 5C

Receptor sequence

>6lqu5C (length=516) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

KERENQNKFERSTYTNNQTKDKKLRAGLKKIDEQYKKAVSSAAATDYLLP
ESNGYLEPENELEKTFKVQQSEIKSSVDVSTANKALDLSLKEFGPYHIKY
AKNGTHLLITGRKGHVASMDWRKGQLRAELFLNETCHSATYLQNEQYFAV
AQKKYTFIYDHEGTELHRLKQHIEARHLDFLPYHYLLVTAGETGWLKYHD
VSTGQLVSELRTKAGPTMAMAQNPWNAVMHLGHSNGTVSLWSPSMPEPLV
KLLSARGPVNSIAIDRSGYYMATTGADRSMKIWDIRNFKQLHSVESLPTP
GTNVSISDTGLLALSRGPHVTLWKDALKLSGDSKPCFGSMGGNPHRNTPY
MSHLFAGNKVENLGFVPFEDLLGVGHQTGITNLIVPGAGEANYDALELNP
FETKKQRQEQEVRTLLNKLPADTITLDPNSIGSVDKRSSTIRLNAKDLAQ
TTMDANNKAKTNSDIPDVKPDVKGKNSGLRSFLRKKTQNVIDERKLRVQK
QLDKEKNIRKRNHQIK

3D structure

PDB

6lqu Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

Chain

Resolution

3.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	5C	T221 L414 K423 Q424 R431 K436	T203 L396 K405 Q406 R413 K418
BS02	rna	5C	K82 F84 K85 Q164 H179 I191 E192 T211 W213 K215 L224 E227 R229 K231 A232 G233 P264 R274 P316 H337 G356 S357 M358 G359 G360 R364 A374 K422 R425 P484 D485 K487 K493 N494 S495 R498 R502 K503 R512 R527 H531	K64 F66 K67 Q146 H161 I173 E174 T193 W195 K197 L206 E209 R211 K213 A214 G215 P246 R256 P298 H319 G338 S339 M340 G341 G342 R346 A356 K404 R407 P466 D467 K469 K475 N476 S477 R480 R484 K485 R494 R509 H513
BS03	rna	5C	D39 K40 K41 A44 K464 A467	D21 K22 K23 A26 K446 A449

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0005515	protein binding

	Biological Process
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364	rRNA processing
GO:0030490	maturation of SSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0030686	90S preribosome
GO:0030688	preribosome, small subunit precursor
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6lqu, PDBe:6lqu, PDBj:6lqu
PDBsum	6lqu
PubMed	32943522
UniProt	P40055\|UTP7_YEAST U3 small nucleolar RNA-associated protein 7 (Gene Name=UTP7)

[Back to BioLiP]