Structure of PDB 6lqp Chain 5B

Receptor sequence
>6lqp5B (length=60) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
IKTKKRKTLKNLRKDSVKRGKFRVQLLSTTQDSKTLPPKKESSIIRSKDR
WLNRKALNKG
3D structure
PDB6lqp Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
Chain5B
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5B K161 K164 K172 G174 R200 S201 R204 W205 K7 K10 K18 G20 R46 S47 R50 W51
Gene Ontology
Molecular Function
GO:0030515 snoRNA binding
GO:0034511 U3 snoRNA binding
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lqp, PDBe:6lqp, PDBj:6lqp
PDBsum6lqp
PubMed32943522
UniProtQ08492|UTP16_YEAST U3 small nucleolar RNA-associated protein 16 (Gene Name=BUD21)

[Back to BioLiP]