Structure of PDB 8g5y Chain 5A

Receptor sequence
>8g5y5A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence]
ATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFT
GKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLP
EGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMA
3D structure
PDB8g5y mRNA decoding in human is kinetically and structurally distinct from bacteria.
Chain5A
Resolution2.29 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5A S46 K47 T48 G49 X50 G52 H53 K55 K68 E70 I72 P74 S31 K32 T33 G34 X35 G37 H38 K40 K53 E55 I57 P59
BS02 rna 5A N28 F30 K39 R86 N13 F15 K24 R71
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 23:19:23 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8g5y', asym_id = '5A', title = 'mRNA decoding in human is kinetically and structurally distinct from bacteria.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8g5y', asym_id='5A', title='mRNA decoding in human is kinetically and structurally distinct from bacteria.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003746,0043022,0045901,0045905', uniprot = '', pdbid = '8g5y', asym_id = '5A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003746,0043022,0045901,0045905', uniprot='', pdbid='8g5y', asym_id='5A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>