Structure of PDB 6gsl Chain 5A

Receptor sequence
>6gsl5A (length=57) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLP
GVRKASW
3D structure
PDB6gsl Tautomeric G•U pairs within the molecular ribosomal grip and fidelity of decoding in bacteria.
Chain5A
Resolution3.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5A A5 L6 E8 K9 R12 K15 F16 K17 V18 R19 Y21 T22 R23 C27 R29 R31 S32 V33 Y34 R35 R41 I42 S60 W61 A1 L2 E4 K5 R8 K11 F12 K13 V14 R15 Y17 T18 R19 C23 R25 R27 S28 V29 Y30 R31 R37 I38 S56 W57
BS02 ZN 5A C40 C43 C36 C39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gsl, PDBe:6gsl, PDBj:6gsl
PDBsum6gsl
PubMed29931292
UniProtP0DOY6|RS14Z_THET8 Small ribosomal subunit protein uS14 (Gene Name=rpsZ)

[Back to BioLiP]