Structure of PDB 4wt1 Chain 5A

Receptor sequence
>4wt15A (length=58) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQL
PGVRKASW
3D structure
PDB4wt1 Structural insights into the translational infidelity mechanism.
Chain5A
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5A K4 A5 K9 K15 F16 K17 V18 R19 Y21 A30 R31 S32 V33 Y34 R41 I42 R45 E46 K58 S60 W61 K1 A2 K6 K12 F13 K14 V15 R16 Y18 A27 R28 S29 V30 Y31 R38 I39 R42 E43 K55 S57 W58
BS02 ZN 5A C24 C27 C40 C43 C21 C24 C37 C40
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Mar 12 01:33:51 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4wt1', asym_id = '5A', title = 'Structural insights into the translational infidelity mechanism.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4wt1', asym_id='5A', title='Structural insights into the translational infidelity mechanism.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4wt1', asym_id = '5A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4wt1', asym_id='5A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>