Structure of PDB 8gzu Chain 52 |
>8gzu52 (length=97) Species: 312017 (Tetrahymena thermophila SB210) [Search protein sequence] |
RDFEYNNQDVNQLNGAFISLVEDEKIGFWVGVGGFAYSQFIMRKFVKSTN IFASVTSLFAGAALANLYTHQSRASYARVAARANRNASLALNKLMEY |
|
PDB | 8gzu Structures of Tetrahymena thermophila respiratory megacomplexes on the tubular mitochondrial cristae. |
Chain | 52 |
Resolution | 4.18 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
52 |
L70 Y71 |
L67 Y68 |
|
|
|