Structure of PDB 8r08 Chain 51 |
>8r0851 (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] |
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNR EPVQLETLSIRGNNIRYFILPDSLPLDTLLVD |
|
PDB | 8r08 Structural insights into the cross-exon to cross-intron spliceosome switch |
Chain | 51 |
Resolution | 6.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
51 |
S35 N49 |
S35 N49 |
|
|
|
|