Structure of PDB 3j6y Chain 51

Receptor sequence

>3j6y51 (length=169) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

PDB

3j6y Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.

Chain

Resolution

6.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	51	K16 N20 S22 F57 I59 I65 H68 N95 N101 G103 G105 D107 G124 D126 Y128 R140 K142	K11 N15 S17 F52 I54 I60 H63 N90 N96 G98 G100 D102 G119 D121 Y123 R135 K137
BS02	rna	51	P8 M9 Q43 T44 H68 V69 T70 R72 G135 R137 V138 R140 R141 T147 S151 H152	P3 M4 Q38 T39 H63 V64 T65 R67 G130 R132 V133 R135 R136 T142 S146 H147

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j6y, PDBe:3j6y, PDBj:3j6y
PDBsum	3j6y
PubMed	24927574
UniProt	P0C0W9\|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]