Structure of PDB 8v9l Chain 5

Receptor sequence
>8v9l5 (length=49) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
DVRPKITLACEVCKHRNYITKKNRRNDPDRLEIKKFCPNCGTHQPHKES
3D structure
PDB8v9l A new family of bacterial ribosome hibernation factors
Chain5
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 R8 Y23 I24 T25 N28 N31 D32 I38 K39 K40 F41 G46 T47 H48 R3 Y18 I19 T20 N23 N26 D27 I33 K34 K35 F36 G41 T42 H43
BS02 ZN 5 C15 C42 C45 C10 C37 C40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v9l, PDBe:8v9l, PDBj:8v9l
PDBsum8v9l
PubMed38355796
UniProtA0QS39|RL331_MYCS2 Large ribosomal subunit protein bL33A (Gene Name=rpmG1)

[Back to BioLiP]