Structure of PDB 8p2h Chain 5

Receptor sequence
>8p2h5 (length=53) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
AVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSYNG
EEV
3D structure
PDB8p2h Staphylococcus aureus 70S ribosome with elongation factor G locked with fusidic acid with a tRNA in pe/E chimeric hybrid state
Chain5
Resolution2.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 A2 V3 P4 K5 R6 R7 T8 S9 K10 T11 R12 K13 K15 R16 R17 T18 H19 F20 T28 S39 H40 R41 Y49 N50 A1 V2 P3 K4 R5 R6 T7 S8 K9 T10 R11 K12 K14 R15 R16 T17 H18 F19 T27 S38 H39 R40 Y48 N49
BS02 ZN 5 C30 C33 C43 C29 C32 C42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2h, PDBe:8p2h, PDBj:8p2h
PDBsum8p2h
PubMed38902339
UniProtQ2FZF1|RL32_STAA8 Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]