Structure of PDB 8j5o Chain 5

Receptor sequence
>8j5o5 (length=38) Species: 383372 (Roseiflexus castenholzii DSM 13941) [Search protein sequence]
RPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRA
3D structure
PDB8j5o Carotenoid assembly regulates quinone diffusion and the Roseiflexus castenholzii reaction center-light harvesting complex architecture.
Chain5
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL 5 F6 V14 S15 F3 V11 S12
BS02 BCL 5 G19 A23 H27 W38 G16 A20 H24 W35
BS03 BCL 5 M22 A23 I26 H27 M19 A20 I23 H24
BS04 BCL 5 F8 S11 F5 S8
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j5o, PDBe:8j5o, PDBj:8j5o
PDBsum8j5o
PubMed37737710
UniProtQ83XD1

[Back to BioLiP]