Structure of PDB 8iwh Chain 5

Receptor sequence

>8iwh5 (length=160) Species: 35128 (Thalassiosira pseudonana) [Search protein sequence]

ESEIGAQAPLGFWDPLGFLDRADQETFDRLRYVELKHGRIAQLAFVGNLI
TRAGYHLPGDISLGRAFADVPNGIAAINGPDAISTAALLQTLAFIGFLET
RVMIDATGESQFRGDFRNGFDFGWDKQSPEWQTNKRAIELNQGRAAMMGI
LGLMMHEQVG

3D structure

PDB

8iwh Structure of a diatom photosystem II supercomplex containing a member of Lhcx family and dimeric FCPII

Chain

Resolution

2.68 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	A86	5	K68 L75 D92 I127 M135	K36 L43 D60 I95 M103
BS02	A86	5	W45 I72 G105	W13 I40 G73
BS03	A86	5	F148 F152 W163	F116 F120 W131
BS04	A86	5	Q74 F77 Q174 G181 L185	Q42 F45 Q142 G149 L153
BS05	CLA	5	A40 P41 A169 I170 N173	A8 P9 A137 I138 N141
BS06	CLA	5	W45 F50 L62 R63 E66 H69 R176 M179 M180	W13 F18 L30 R31 E34 H37 R144 M147 M148
BS07	KC2	5	V65 H69	V33 H37
BS08	CLA	5	L75 V78 G79 I82 T83 H88 L89 F99 V102	L43 V46 G47 I50 T51 H56 L57 F67 V70
BS09	CLA	5	A119 Q122 T123 F126	A87 Q90 T91 F94
BS10	CLA	5	K68 H69 L124 G128 E131	K36 H37 L92 G96 E99
BS11	CLA	5	R71 Q74 D147 R149 G155 K167 E171	R39 Q42 D115 R117 G123 K135 E139
BS12	KC1	5	I170 Q174	I138 Q142
BS13	CLA	5	M180 M187 H188	M148 M155 H156

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8iwh, PDBe:8iwh, PDBj:8iwh
PDBsum	8iwh
PubMed	37878698
UniProt	B8BX92

[Back to BioLiP]