Structure of PDB 8cku Chain 5

Receptor sequence
>8cku5 (length=53) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ENVWFSHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFN
KFR
3D structure
PDB8cku mRNA reading frame maintenance during eukaryotic ribosome translocation
Chain5
Resolution3.11 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 W7 F8 S9 H10 P11 R12 R13 Y14 G15 K16 G17 R19 H27 G29 L30 I31 R32 K33 Y34 R40 Q41 C42 R44 E45 F55 R56 W4 F5 S6 H7 P8 R9 R10 Y11 G12 K13 G14 R16 H24 G26 L27 I28 R29 K30 Y31 R37 Q38 C39 R41 E42 F52 R53
BS02 ZN 5 C21 C39 C42 C18 C36 C39
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Nov 27 13:34:54 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8cku', asym_id = '5', title = 'mRNA reading frame maintenance during eukaryotic ribosome translocation'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8cku', asym_id='5', title='mRNA reading frame maintenance during eukaryotic ribosome translocation')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008270', uniprot = '', pdbid = '8cku', asym_id = '5'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008270', uniprot='', pdbid='8cku', asym_id='5')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>